Lineage for d1ffkr_ (1ffk R:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271116Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 271117Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families) (S)
  5. 271219Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
  6. 271220Protein Ribosomal protein L24e [57750] (1 species)
  7. 271221Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (8 PDB entries)
  8. 271225Domain d1ffkr_: 1ffk R: [45152]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_
    complexed with cd, k, mo3; mutant

Details for d1ffkr_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkr_ g.39.1.6 (R:) Ribosomal protein L24e {Archaeon Haloarcula marismortui}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOP Domain Coordinates for d1ffkr_:

Click to download the PDB-style file with coordinates for d1ffkr_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkr_: