SCOPe 2.05: Domain d1imla2: 1iml A:29-76

Lineage for d1imla2 (1iml A:29-76)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (4 species)

7. Species Rat (Rattus rattus) [TaxId:10117] [57740] (1 PDB entry)

8. Domain d1imla2: 1iml A:29-76 [45146]
   complexed with zn

Details for d1imla2

PDB Entry: 1iml

PDB Description: cysteine rich intestinal protein, nmr, 48 structures

PDB Compounds: (A:) cysteine rich intestinal protein

SCOPe Domain Sequences for d1imla2:

Sequence; same for both SEQRES and ATOM records:

>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]}
kcekcgktltsgghaehegkpycnhpcysamfgpkgfgrggaeshtfk

Timeline for d1imla2:

• d1imla2 first appeared (with stable ids) in SCOP 1.55, called d1iml_2
  
• d1imla2 appears in SCOPe 2.04
  
• d1imla2 appears in SCOPe 2.06
  
• d1imla2 appears in the current release, SCOPe 2.08