Class g: Small proteins [56992] (92 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (4 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [57738] (2 PDB entries) |
Domain d1b8ta2: 1b8t A:36-100 [45136] complexed with zn |
PDB Entry: 1b8t (more details)
SCOPe Domain Sequences for d1b8ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} lcmvckknldsttvavhgdeiyckscygkkygpkgkgkgmgagtlstdkgeslgikyeeg qshrp
Timeline for d1b8ta2: