SCOPe 2.05: Domain d1b8ta2: 1b8t A:36-100

Lineage for d1b8ta2 (1b8t A:36-100)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (4 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [57738] (2 PDB entries)

8. Domain d1b8ta2: 1b8t A:36-100 [45136]
   complexed with zn

Details for d1b8ta2

PDB Entry: 1b8t

PDB Description: solution structure of the chicken crp1

PDB Compounds: (A:) protein (crp1)

SCOPe Domain Sequences for d1b8ta2:

Sequence; same for both SEQRES and ATOM records:

>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]}
lcmvckknldsttvavhgdeiyckscygkkygpkgkgkgmgagtlstdkgeslgikyeeg
qshrp

Timeline for d1b8ta2:

• d1b8ta2 first appeared (with stable ids) in SCOP 1.55
  
• d1b8ta2 appears in SCOPe 2.04
  
• d1b8ta2 appears in SCOPe 2.06
  
• d1b8ta2 appears in the current release, SCOPe 2.08