Lineage for d1hraa_ (1hra A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965176Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1965177Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1965201Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 1965251Protein Retinoic acid receptor DNA-binding domain [57732] (1 species)
  7. 1965252Species Human (Homo sapiens) [TaxId:9606] [57733] (2 PDB entries)
  8. 1965254Domain d1hraa_: 1hra A: [45130]
    complexed with zn

Details for d1hraa_

PDB Entry: 1hra (more details)

PDB Description: the solution structure of the human retinoic acid receptor-beta dna- binding domain
PDB Compounds: (A:) retinoic acid receptor

SCOPe Domain Sequences for d1hraa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hraa_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
mprvykpcfvcqdkssgyhygvsacegckgffrrsiqknmiytchrdkncvinkvtrnrc
qycrlqkcfevgmskesvrn

SCOPe Domain Coordinates for d1hraa_:

Click to download the PDB-style file with coordinates for d1hraa_.
(The format of our PDB-style files is described here.)

Timeline for d1hraa_: