Lineage for d1wwww_ (1www W:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638544Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 2638545Protein beta-Nerve growth factor [57525] (2 species)
  7. 2638546Species Human (Homo sapiens) [TaxId:9606] [57527] (6 PDB entries)
    Uniprot P01138
  8. 2638548Domain d1wwww_: 1www W: [44808]
    Other proteins in same PDB: d1wwwx_, d1wwwy_

Details for d1wwww_

PDB Entry: 1www (more details), 2.2 Å

PDB Description: ngf in complex with domain 5 of the trka receptor
PDB Compounds: (W:) protein (nerve growth factor)

SCOPe Domain Sequences for d1wwww_:

Sequence, based on SEQRES records: (download)

>d1wwww_ g.17.1.3 (W:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdp
npvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka

Sequence, based on observed residues (ATOM records): (download)

>d1wwww_ g.17.1.3 (W:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdg
crgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka

SCOPe Domain Coordinates for d1wwww_:

Click to download the PDB-style file with coordinates for d1wwww_.
(The format of our PDB-style files is described here.)

Timeline for d1wwww_: