Lineage for d1wwww_ (1www W:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40812Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 40813Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) (S)
  5. 40877Family g.17.1.3: Neurotrophin [57520] (3 proteins)
  6. 40878Protein beta-Nerve growth factor [57525] (2 species)
  7. 40879Species Human (Homo sapiens) [TaxId:9606] [57527] (1 PDB entry)
  8. 40881Domain d1wwww_: 1www W: [44808]
    Other proteins in same PDB: d1wwwx_, d1wwwy_

Details for d1wwww_

PDB Entry: 1www (more details), 2.2 Å

PDB Description: ngf in complex with domain 5 of the trka receptor

SCOP Domain Sequences for d1wwww_:

Sequence, based on SEQRES records: (download)

>d1wwww_ g.17.1.3 (W:) beta-Nerve growth factor {Human (Homo sapiens)}
sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdp
npvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka

Sequence, based on observed residues (ATOM records): (download)

>d1wwww_ g.17.1.3 (W:) beta-Nerve growth factor {Human (Homo sapiens)}
sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdg
crgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka

SCOP Domain Coordinates for d1wwww_:

Click to download the PDB-style file with coordinates for d1wwww_.
(The format of our PDB-style files is described here.)

Timeline for d1wwww_: