SCOP 1.59: Domain d2vpfa_: 2vpf A:

Lineage for d2vpfa_ (2vpf A:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (6 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (7 PDB entries)

8. Domain d2vpfa_: 2vpf A: [44755]

Details for d2vpfa_

PDB Entry: 2vpf, 1.93 Å

PDB Description: vascular endothelial growth factor refined to 1.93 angstroms resolution

SCOP Domain Sequences for d2vpfa_:

Sequence; same for both SEQRES and ATOM records:

>d2vpfa_ g.17.1.1 (A:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkkd

Timeline for d2vpfa_:

• d2vpfa_ first appeared (with stable ids) in SCOP 1.55
  
• d2vpfa_ appears in SCOP 1.57
  
• d2vpfa_ appears in SCOP 1.61
  
• d2vpfa_ appears in the current release, SCOPe 2.08