Lineage for d2hpqp_ (2hpq P:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963115Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1963116Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 1963117Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 1963127Protein Meizothrombin [57450] (2 species)
  7. 1963132Species Human (Homo sapiens) [TaxId:9606] [57452] (1 PDB entry)
  8. 1963133Domain d2hpqp_: 2hpq P: [44657]
    Other proteins in same PDB: d2hpq.1
    complexed with 0g7

Details for d2hpqp_

PDB Entry: 2hpq (more details), 3.3 Å

PDB Description: Structures of the noncovalent complexes of human and bovine prothrombin fragment 2 with human ppack-thrombin
PDB Compounds: (P:) Prothrombin

SCOPe Domain Sequences for d2hpqp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hpqp_ g.14.1.1 (P:) Meizothrombin {Human (Homo sapiens) [TaxId: 9606]}
cvpdrgqqyqgrlavtthglpclawasaqakalskhqdfnsavqlvenfcrnpdgdeegv
wcyvagkpgdfgycdlnyc

SCOPe Domain Coordinates for d2hpqp_:

Click to download the PDB-style file with coordinates for d2hpqp_.
(The format of our PDB-style files is described here.)

Timeline for d2hpqp_: