SCOP 1.59: Domain d2pf1_1: 2pf1 66-156

Lineage for d2pf1_1 (2pf1 66-156)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Prothrombin kringle domain [57448] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57449] (3 PDB entries)

8. Domain d2pf1_1: 2pf1 66-156 [44652]
   Other proteins in same PDB: d2pf1_2

Details for d2pf1_1

PDB Entry: 2pf1, 2.2 Å

PDB Description: structure of bovine prothrombin fragment 1 refined at 2.25 angstroms resolution

SCOP Domain Sequences for d2pf1_1:

Sequence; same for both SEQRES and ATOM records:

>d2pf1_1 g.14.1.1 (66-156) Prothrombin kringle domain {Cow (Bos taurus)}
caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp
wcyttsptlrreecsvpvcgqdrvtvevipr

Timeline for d2pf1_1:

• d2pf1_1 first appeared (with stable ids) in SCOP 1.55
  
• d2pf1_1 appears in SCOP 1.57
  
• d2pf1_1 appears in SCOP 1.61
  
• d2pf1_1 appears in the current release, SCOPe 2.08, called d2pf1a1