Lineage for d2pf1_1 (2pf1 66-156)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.14: Kringle-like [57439] (1 superfamily) Superfamily g.14.1: Kringle-like [57440] (2 families) 
Family g.14.1.1: Kringle modules [57441] (8 proteins) 
Protein Prothrombin fragment 1 and 2 [57448] (1 species) Species Cow (Bos taurus) [TaxId:9913] [57449] (3 PDB entries) 
Domain d2pf1_1: 2pf1 66-156 [44652]
Other proteins in same PDB: d2pf1_2
Details for d2pf1_1
PDB Entry: 2pf1 (more details), 2.2 Å
PDB Description: structure of bovine prothrombin fragment 1 refined at 2.25 angstroms resolution
SCOP Domain Sequences for d2pf1_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pf1_1 g.14.1.1 (66-156) Prothrombin fragment 1 and 2 {Cow (Bos taurus)}
caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp
wcyttsptlrreecsvpvcgqdrvtvevipr
SCOP Domain Coordinates for d2pf1_1:
Click to download the PDB-style file with coordinates for d2pf1_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pf1_1:
- d2pf1_1 appears in SCOP 1.57
- d2pf1_1 appears in the current release, SCOPe 2.08, called d2pf1a1
View in 3D
