Lineage for d2pf1_2 (2pf1 36-65)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41158Fold g.32: GLA-domain [57629] (1 superfamily)
  4. 41159Superfamily g.32.1: GLA-domain [57630] (1 family) (S)
  5. 41160Family g.32.1.1: GLA-domain [57631] (4 proteins)
  6. 41176Protein Prothrombin [57634] (1 species)
  7. 41177Species Cow (Bos taurus) [TaxId:9913] [57635] (3 PDB entries)
  8. 41179Domain d2pf1_2: 2pf1 36-65 [44968]
    Other proteins in same PDB: d2pf1_1

Details for d2pf1_2

PDB Entry: 2pf1 (more details), 2.2 Å

PDB Description: structure of bovine prothrombin fragment 1 refined at 2.25 angstroms resolution

SCOP Domain Sequences for d2pf1_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pf1_2 g.32.1.1 (36-65) Prothrombin {Cow (Bos taurus)}
satdafwakytacesarnpreklneclegn

SCOP Domain Coordinates for d2pf1_2:

Click to download the PDB-style file with coordinates for d2pf1_2.
(The format of our PDB-style files is described here.)

Timeline for d2pf1_2:

41179
d2pf1_2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2pf1_1