Class g: Small proteins [56992] (61 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulphide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (2 families) |
Family g.14.1.1: Kringle modules [57441] (6 proteins) |
Protein Plasminogen [63400] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63401] (16 PDB entries) |
Domain d1cebb_: 1ceb B: [44648] kringle 1 complexed with amh |
PDB Entry: 1ceb (more details), 2.1 Å
SCOP Domain Sequences for d1cebb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cebb_ g.14.1.1 (B:) Plasminogen {Human (Homo sapiens)} ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg pwcyttdpekrydycdilec
Timeline for d1cebb_: