SCOP 1.63: Domain d1cebb_: 1ceb B:

Lineage for d1cebb_ (1ceb B:)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulphide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (6 proteins)

6. Protein Plasminogen [63400] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63401] (16 PDB entries)

8. Domain d1cebb_: 1ceb B: [44648]
   kringle 1
   complexed with amh

Details for d1cebb_

PDB Entry: 1ceb, 2.1 Å

PDB Description: the structure of the non-covalent complex of recombinant kringle 1 domain of human plasminogen with amcha (trans-4- aminomethylcyclohexane-1-carboxylic acid)

SCOP Domain Sequences for d1cebb_:

Sequence; same for both SEQRES and ATOM records:

>d1cebb_ g.14.1.1 (B:) Plasminogen {Human (Homo sapiens)}
ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
pwcyttdpekrydycdilec

Timeline for d1cebb_:

• d1cebb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cebb_ appears in SCOP 1.61
  
• d1cebb_ appears in SCOP 1.65
  
• d1cebb_ appears in the current release, SCOPe 2.08