PDB entry 1ceb

View 1ceb on RCSB PDB site
Description: the structure of the non-covalent complex of recombinant kringle 1 domain of human plasminogen with amcha (trans-4- aminomethylcyclohexane-1-carboxylic acid)
Deposited on 1995-12-03, released 1996-04-03
The last revision prior to the SCOP 1.63 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ceba_
  • Chain 'B':
    Domains in SCOP 1.63: d1cebb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cebA (A:)
    ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
    pwcyttdpekrydycdilec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cebB (B:)
    ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
    pwcyttdpekrydycdilec