SCOPe 2.02: Domain d1tawb_: 1taw B:

Lineage for d1tawb_ (1taw B:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57371] (4 PDB entries)

8. Domain d1tawb_: 1taw B: [44545]
   Other proteins in same PDB: d1tawa_
   complexed with ca

Details for d1tawb_

PDB Entry: 1taw, 1.8 Å

PDB Description: bovine trypsin complexed to appi

PDB Compounds: (B:) protease inhibitor domain of alzheimer's amyloid beta-protein precursor

SCOPe Domain Sequences for d1tawb_:

Sequence; same for both SEQRES and ATOM records:

>d1tawb_ g.8.1.1 (B:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]}
evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg

Timeline for d1tawb_:

• d1tawb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tawb_ appears in SCOPe 2.01
  
• d1tawb_ appears in SCOPe 2.03
  
• d1tawb_ appears in the current release, SCOPe 2.08