Lineage for d1tfxd_ (1tfx D:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032521Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 3032697Protein Tissue factor pathway inhibitor [57368] (1 species)
  7. 3032698Species Human (Homo sapiens) [TaxId:9606] [57369] (4 PDB entries)
  8. 3032702Domain d1tfxd_: 1tfx D: [44541]
    Other proteins in same PDB: d1tfxa_, d1tfxb_
    second kunitz domain
    complexed with ca

Details for d1tfxd_

PDB Entry: 1tfx (more details), 2.6 Å

PDB Description: complex of the second kunitz domain of tissue factor pathway inhibitor with porcine trypsin
PDB Compounds: (D:) tissue factor pathway inhibitor

SCOPe Domain Sequences for d1tfxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfxd_ g.8.1.1 (D:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]}
kpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleecknicedg

SCOPe Domain Coordinates for d1tfxd_:

Click to download the PDB-style file with coordinates for d1tfxd_.
(The format of our PDB-style files is described here.)

Timeline for d1tfxd_: