SCOPe 2.02: Domain d3btwi_: 3btw I:

Lineage for d3btwi_ (3btw I:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57365] (85 PDB entries)

8. Domain d3btwi_: 3btw I: [44496]
   Other proteins in same PDB: d3btwe_
   complexed with ca, so4

Details for d3btwi_

PDB Entry: 3btw, 2.05 Å

PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti

PDB Compounds: (I:) protein (bovine pancreatic trypsin inhibitor)

SCOPe Domain Sequences for d3btwi_:

Sequence; same for both SEQRES and ATOM records:

>d3btwi_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
dfcleppytgpcwariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

Timeline for d3btwi_:

• d3btwi_ first appeared (with stable ids) in SCOP 1.55
  
• d3btwi_ appears in SCOPe 2.01
  
• d3btwi_ appears in SCOPe 2.03
  
• d3btwi_ appears in the current release, SCOPe 2.08