Lineage for d1ctxa_ (1ctx A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032125Protein alpha-Cobratoxin [57318] (3 species)
  7. 3032126Species Cobra (Naja siamensis) [TaxId:84476] [57319] (3 PDB entries)
  8. 3032128Domain d1ctxa_: 1ctx A: [44421]

Details for d1ctxa_

PDB Entry: 1ctx (more details), 2.8 Å

PDB Description: three-dimensional structure of the-long-neurotoxin from cobra venom
PDB Compounds: (A:) alpha-cobratoxin

SCOPe Domain Sequences for d1ctxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctxa_ g.7.1.1 (A:) alpha-Cobratoxin {Cobra (Naja siamensis) [TaxId: 84476]}
ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
ncnpfptrkrp

SCOPe Domain Coordinates for d1ctxa_:

Click to download the PDB-style file with coordinates for d1ctxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ctxa_: