Lineage for d1c9tl_ (1c9t L:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 342425Superfamily g.3.15: Leech antihemostatic proteins [57262] (2 families) (S)
  5. 342426Family g.3.15.1: Huristasin-like [57263] (3 proteins)
  6. 342427Protein Bdellastasin [57266] (1 species)
  7. 342428Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57267] (3 PDB entries)
  8. 342436Domain d1c9tl_: 1c9t L: [44365]
    Other proteins in same PDB: d1c9ta_, d1c9tb_, d1c9tc_, d1c9td_, d1c9te_, d1c9tf_

Details for d1c9tl_

PDB Entry: 1c9t (more details), 3.3 Å

PDB Description: complex of bdellastasin with bovine trypsin

SCOP Domain Sequences for d1c9tl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9tl_ g.3.15.1 (L:) Bdellastasin {Medicinal leech (Hirudo medicinalis)}
ttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq

SCOP Domain Coordinates for d1c9tl_:

Click to download the PDB-style file with coordinates for d1c9tl_.
(The format of our PDB-style files is described here.)

Timeline for d1c9tl_: