Lineage for d1pbia_ (1pbi A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 89048Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) (S)
  5. 89049Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein)
  6. 89050Protein Bowman-Birk inhibitor, BBI [57249] (6 species)
  7. 89064Species Winter pea (Pisum sativum) [TaxId:3888] [57252] (1 PDB entry)
  8. 89065Domain d1pbia_: 1pbi A: [44346]

Details for d1pbia_

PDB Entry: 1pbi (more details), 2.7 Å

PDB Description: crystal structure of a bowman-birk inhibitor from pea seeds

SCOP Domain Sequences for d1pbia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbia_ g.3.13.1 (A:) Bowman-Birk inhibitor, BBI {Winter pea (Pisum sativum)}
ksaccdtclctksnpptcrcvdvgetchsaclscicaysnppkcqcfdtqkfcykqchns
eleevikn

SCOP Domain Coordinates for d1pbia_:

Click to download the PDB-style file with coordinates for d1pbia_.
(The format of our PDB-style files is described here.)

Timeline for d1pbia_:

89065
d1pbia_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1pbib_