PDB entry 1pbi

View 1pbi on RCSB PDB site
Description: crystal structure of a bowman-birk inhibitor from pea seeds
Deposited on 1998-08-20, released 1999-01-27
The last revision prior to the SCOP 1.57 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.214
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1pbia_
  • Chain 'B':
    Domains in SCOP 1.57: d1pbib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pbiA (A:)
ksaccdtclctksnpptcrcvdvgetchsaclscicaysnppkcqcfdtqkfcykqchns
eleevikn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pbiB (B:)
ksaccdtclctksnpptcrcvdvgetchsaclscicaysnppkcqcfdtqkfcykqchns
eleevikn