Lineage for d1apq__ (1apq -)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142669Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 143091Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 143092Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 143116Protein Complement protease C1R [57229] (1 species)
  7. 143117Species Human (Homo sapiens) [TaxId:9606] [57230] (1 PDB entry)
  8. 143118Domain d1apq__: 1apq - [44324]

Details for d1apq__

PDB Entry: 1apq (more details)

PDB Description: structure of the egf-like module of human c1r, nmr, 19 structures

SCOP Domain Sequences for d1apq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apq__ g.3.11.1 (-) Complement protease C1R {Human (Homo sapiens)}
avdldecasrsksgeedpqpqcqhlchnyvggyfcscrpgyelqedrhscqae

SCOP Domain Coordinates for d1apq__:

Click to download the PDB-style file with coordinates for d1apq__.
(The format of our PDB-style files is described here.)

Timeline for d1apq__: