PDB entry 1apq

View 1apq on RCSB PDB site
Description: structure of the egf-like module of human c1r, nmr, 19 structures
Deposited on 1997-07-22, released 1997-09-17
The last revision prior to the SCOP 1.59 freeze date was dated 1997-09-17, with a file datestamp of 1997-09-17.
Experiment type: NMR19
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1apq__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1apq_ (-)
    avdldecasrsksgeedpqpqcqhlchnyvggyfcscrpgyelqedrhscqae