Lineage for d1emn_2 (1emn 2167-2205)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 521093Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 521739Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 521740Family g.3.11.1: EGF-type module [57197] (21 proteins)
  6. 521872Protein Fibrillin-1 [57227] (1 species)
    duplication: contains 47 EFG-like domains
  7. 521873Species Human (Homo sapiens) [TaxId:9606] [57228] (6 PDB entries)
  8. 521887Domain d1emn_2: 1emn 2167-2205 [44323]
    39th and 40th calcium-binding EGF-like domains

Details for d1emn_2

PDB Entry: 1emn (more details)

PDB Description: nmr study of a pair of fibrillin ca2+ binding epidermal growth factor- like domains, minimized average structure

SCOP Domain Sequences for d1emn_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emn_2 g.3.11.1 (2167-2205) Fibrillin-1 {Human (Homo sapiens)}
tdecsvgnpcgngtcknviggfectceegfepgpmmtce

SCOP Domain Coordinates for d1emn_2:

Click to download the PDB-style file with coordinates for d1emn_2.
(The format of our PDB-style files is described here.)

Timeline for d1emn_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1emn_1