Lineage for d1emn_2 (1emn 2167-2205)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies) 
Superfamily g.3.11: EGF/Laminin [57196] (4 families) 
Family g.3.11.1: EGF-type module [57197] (16 proteins) 
Protein Fibrillin-1 fragment (residues 2124-2205) [57227] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57228] (2 PDB entries) 
Domain d1emn_2: 1emn 2167-2205 [44323]
Details for d1emn_2
PDB Entry: 1emn (more details)
PDB Description: nmr study of a pair of fibrillin ca2+ binding epidermal growth factor- like domains, minimized average structure
SCOP Domain Sequences for d1emn_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1emn_2 g.3.11.1 (2167-2205) Fibrillin-1 fragment (residues 2124-2205) {Human (Homo sapiens)}
tdecsvgnpcgngtcknviggfectceegfepgpmmtce
SCOP Domain Coordinates for d1emn_2:
Click to download the PDB-style file with coordinates for d1emn_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1emn_2:
- d1emn_2 appears in SCOP 1.57
- d1emn_2 appears in the current release, SCOPe 2.08, called d1emna2
View in 3D
