PDB entry 1emn

View 1emn on RCSB PDB site
Description: nmr study of a pair of fibrillin ca2+ binding epidermal growth factor- like domains, minimized average structure
Deposited on 1996-08-05, released 1996-12-23
The last revision prior to the SCOP 1.69 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1emn_ (-)
    savdmdeckepdvckhgqcintdgsyrcecpfgyilagnecvdtdecsvgnpcgngtckn
    viggfectceegfepgpmmtce