Lineage for d1adxa_ (1adx A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1240201Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1240965Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1240966Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1241312Protein Thrombomodulin, different EGF-like domains [57225] (1 species)
  7. 1241313Species Human (Homo sapiens) [TaxId:9606] [57226] (6 PDB entries)
  8. 1241328Domain d1adxa_: 1adx A: [44315]

Details for d1adxa_

PDB Entry: 1adx (more details)

PDB Description: fifth egf-like domain of thrombomodulin (tmegf5), nmr, 14 structures
PDB Compounds: (A:) thrombomodulin

SCOPe Domain Sequences for d1adxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adxa_ g.3.11.1 (A:) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
qmfcnqtacpadcdpntqascecpegyilddgfictdide

SCOPe Domain Coordinates for d1adxa_:

Click to download the PDB-style file with coordinates for d1adxa_.
(The format of our PDB-style files is described here.)

Timeline for d1adxa_: