SCOPe 2.03: Domain d1ddxc2: 1ddx C:2033-2073

Lineage for d1ddxc2 (1ddx C:2033-2073)

Root: SCOPe 2.03
Class g: Small proteins [56992] (90 folds)
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.11: EGF/Laminin [57196] (8 families)
Family g.3.11.1: EGF-type module [57197] (23 proteins)
Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
the rest of protein is heme-linked peroxidase, all-alpha fold
Species Mouse (Mus musculus) [TaxId:10090] [57212] (11 PDB entries)
Domain d1ddxc2: 1ddx C:2033-2073 [44277]
Other proteins in same PDB: d1ddxa1, d1ddxb1, d1ddxc1, d1ddxd1
complexed with bog, nag, pgx

Details for d1ddxc2

PDB Description: crystal structure of a mixture of arachidonic acid and prostaglandin bound to the cyclooxygenase active site of cox-2: prostaglandin structure

PDB Compounds: (C:) protein (prostaglandin h2 synthase-2)

SCOPe Domain Sequences for d1ddxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddxc2 g.3.11.1 (C:2033-2073) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOPe Domain Coordinates for d1ddxc2:

Click to download the PDB-style file with coordinates for d1ddxc2.
(The format of our PDB-style files is described here.)

Timeline for d1ddxc2: