SCOPe 2.08: Domain d1ddxc2: 1ddx C:2033-2073

Lineage for d1ddxc2 (1ddx C:2033-2073)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries)

8. Domain d1ddxc2: 1ddx C:2033-2073 [44277]
   Other proteins in same PDB: d1ddxa1, d1ddxb1, d1ddxc1, d1ddxd1
   complexed with bog, nag, pgx

Details for d1ddxc2

PDB Entry: 1ddx, 3 Å

PDB Description: crystal structure of a mixture of arachidonic acid and prostaglandin bound to the cyclooxygenase active site of cox-2: prostaglandin structure

PDB Compounds: (C:) protein (prostaglandin h2 synthase-2)

SCOPe Domain Sequences for d1ddxc2:

Sequence; same for both SEQRES and ATOM records:

>d1ddxc2 g.3.11.1 (C:2033-2073) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d1ddxc2:

• d1ddxc2 first appeared (with stable ids) in SCOP 1.55
  
• d1ddxc2 appears in SCOPe 2.07