Lineage for d1ddxb2 (1ddx B:1033-1073)
- Root: SCOPe 2.07
Class g: Small proteins [56992] (98 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.11: EGF/Laminin [57196] (8 families) 
Family g.3.11.1: EGF-type module [57197] (23 proteins) 
Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
the rest of protein is heme-linked peroxidase, all-alpha foldSpecies Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries) 
Domain d1ddxb2: 1ddx B:1033-1073 [44276]
Other proteins in same PDB: d1ddxa1, d1ddxb1, d1ddxc1, d1ddxd1
complexed with bog, nag, pgx
Details for d1ddxb2
PDB Entry: 1ddx (more details), 3 Å
PDB Description: crystal structure of a mixture of arachidonic acid and prostaglandin bound to the cyclooxygenase active site of cox-2: prostaglandin structure
PDB Compounds: (B:) protein (prostaglandin h2 synthase-2)SCOPe Domain Sequences for d1ddxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ddxb2 g.3.11.1 (B:1033-1073) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe
SCOPe Domain Coordinates for d1ddxb2:
Click to download the PDB-style file with coordinates for d1ddxb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ddxb2:
View in 3D
