SCOPe 2.02: Domain d3pgha2: 3pgh A:33-73

Lineage for d3pgha2 (3pgh A:33-73)

Root: SCOPe 2.02
Class g: Small proteins [56992] (90 folds)
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.11: EGF/Laminin [57196] (7 families)
Family g.3.11.1: EGF-type module [57197] (23 proteins)
Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
the rest of protein is heme-linked peroxidase, all-alpha fold
Species Mouse (Mus musculus) [TaxId:10090] [57212] (8 PDB entries)
Domain d3pgha2: 3pgh A:33-73 [44269]
Other proteins in same PDB: d3pgha1, d3pghb1, d3pghc1, d3pghd1
complexed with flp, hem, nag

Details for d3pgha2

PDB Entry: 3pgh (more details), 2.5 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a non- selective inhibitor, flurbiprofen

PDB Compounds: (A:) cyclooxygenase-2

SCOPe Domain Sequences for d3pgha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pgha2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOPe Domain Coordinates for d3pgha2:

Click to download the PDB-style file with coordinates for d3pgha2.
(The format of our PDB-style files is described here.)

Timeline for d3pgha2: