SCOPe 2.02: Domain d1prha2: 1prh A:33-73

Lineage for d1prha2 (1prh A:33-73)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Sheep (Ovis aries) [TaxId:9940] [57211] (20 PDB entries)
   Uniprot P05979 32-584

8. Domain d1prha2: 1prh A:33-73 [44253]
   Other proteins in same PDB: d1prha1, d1prhb1
   complexed with hem

Details for d1prha2

PDB Entry: 1prh, 3.5 Å

PDB Description: the x-ray crystal structure of the membrane protein prostaglandin h2 synthase-1

PDB Compounds: (A:) prostaglandin h2 synthase-1

SCOPe Domain Sequences for d1prha2:

Sequence; same for both SEQRES and ATOM records:

>d1prha2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d1prha2:

• d1prha2 first appeared (with stable ids) in SCOP 1.55
  
• d1prha2 appears in SCOPe 2.01
  
• d1prha2 appears in SCOPe 2.03
  
• d1prha2 appears in the current release, SCOPe 2.08