Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein E-selectin, EGF-domain [57203] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries) |
Domain d1esla2: 1esl A:119-157 [44225] Other proteins in same PDB: d1esla1 complexed with ca, cl |
PDB Entry: 1esl (more details), 2 Å
SCOPe Domain Sequences for d1esla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1esla2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} taactntscsghgecvetinnytckcdpgfsglkceqiv
Timeline for d1esla2: