Lineage for d1cvwl_ (1cvw L:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1240201Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1240965Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1240966Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1240975Protein Coagulation factor VIIa [57201] (1 species)
  7. 1240976Species Human (Homo sapiens) [TaxId:9606] [57202] (35 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 1240998Domain d1cvwl_: 1cvw L: [44211]
    Other proteins in same PDB: d1cvwh_
    complexed with ca

Details for d1cvwl_

PDB Entry: 1cvw (more details), 2.28 Å

PDB Description: crystal structure of active site-inhibited human coagulation factor viia (des-gla)
PDB Compounds: (L:) coagulation factor viia (light chain) (des-gla)

SCOPe Domain Sequences for d1cvwl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvwl_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

SCOPe Domain Coordinates for d1cvwl_:

Click to download the PDB-style file with coordinates for d1cvwl_.
(The format of our PDB-style files is described here.)

Timeline for d1cvwl_: