Lineage for d1djtb_ (1djt B:)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfidesSuperfamily g.3.7: Scorpion toxin-like [57095] (6 families) 
Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) Protein Scorpion toxin [57097] (17 species) 
Species Chinese scorpion (Buthus martensii), toxin m1 [TaxId:34649] [57106] (11 PDB entries)
Uniprot P45697
Domain d1djtb_: 1djt B: [44133]
Details for d1djtb_
PDB Entry: 1djt (more details), 1.2 Å
PDB Description: atomic resolution structure of scorpion alpha-like toxin bmk m1 in a new crystal form
PDB Compounds: (B:) alpha-like neurotoxin bmk m1SCOPe Domain Sequences for d1djtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1djtb_ g.3.7.1 (B:) Scorpion toxin {Chinese scorpion (Buthus martensii), toxin m1 [TaxId: 34649]}
vrdayiakphncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpirvp
gkch
SCOPe Domain Coordinates for d1djtb_:
Click to download the PDB-style file with coordinates for d1djtb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1djtb_:
- d1djtb_ first appeared (with stable ids) in SCOP 1.55
- d1djtb_ appears in SCOPe 2.07
View in 3D
