Lineage for d3lria_ (3lri A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029834Protein Insulin-like growth factor [57002] (1 species)
  7. 3029835Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
    Uniprot P05019 49-110
  8. 3029857Domain d3lria_: 3lri A: [43995]

Details for d3lria_

PDB Entry: 3lri (more details)

PDB Description: solution structure and backbone dynamics of long-[arg(3)]insulin-like growth factor-i
PDB Compounds: (A:) protein (insulin-like growth factor I)

SCOPe Domain Sequences for d3lria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lria_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
mfpamplsslfvngprtlcgaelvdalqfvcgdrgfyfnkptgygsssrracqtgivdec
cfrscdlrrlemycaplkpaksa

SCOPe Domain Coordinates for d3lria_:

Click to download the PDB-style file with coordinates for d3lria_.
(The format of our PDB-style files is described here.)

Timeline for d3lria_: