Lineage for d3gf1__ (3gf1 -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88228Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 88229Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 88230Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 88416Protein Insulin-like growth factor [57002] (1 species)
  7. 88417Species Human (Homo sapiens) [TaxId:9606] [57003] (7 PDB entries)
  8. 88422Domain d3gf1__: 3gf1 - [43992]

Details for d3gf1__

PDB Entry: 3gf1 (more details)

PDB Description: solution structure of human insulin-like growth factor 1: a nuclear magnetic resonance and restrained molecular dynamics study

SCOP Domain Sequences for d3gf1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gf1__ g.1.1.1 (-) Insulin-like growth factor {Human (Homo sapiens)}
gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
caplkpaksa

SCOP Domain Coordinates for d3gf1__:

Click to download the PDB-style file with coordinates for d3gf1__.
(The format of our PDB-style files is described here.)

Timeline for d3gf1__: