![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
![]() | Superfamily g.1.1: Insulin-like [56994] (1 family) ![]() |
![]() | Family g.1.1.1: Insulin-like [56995] (5 proteins) |
![]() | Protein Insulin-like growth factor [57002] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries) Uniprot P05019 49-110 |
![]() | Domain d3gf1a_: 3gf1 A: [43992] |
PDB Entry: 3gf1 (more details)
SCOPe Domain Sequences for d3gf1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gf1a_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]} gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy caplkpaksa
Timeline for d3gf1a_: