Lineage for d1qlbf_ (1qlb F:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697409Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1697498Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 1697499Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (2 proteins)
    duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry
  6. 1697500Protein Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56911] (1 species)
  7. 1697501Species Wolinella succinogenes [TaxId:844] [56913] (4 PDB entries)
  8. 1697504Domain d1qlbf_: 1qlb F: [43725]
    Other proteins in same PDB: d1qlba1, d1qlba2, d1qlba3, d1qlbb1, d1qlbb2, d1qlbd1, d1qlbd2, d1qlbd3, d1qlbe1, d1qlbe2
    complexed with ca, f3s, fad, fes, fum, hem, lmt, sf4

Details for d1qlbf_

PDB Entry: 1qlb (more details), 2.33 Å

PDB Description: respiratory complex II-like fumarate reductase from Wolinella succinogenes
PDB Compounds: (F:) fumarate reductase cytochrome b subunit

SCOPe Domain Sequences for d1qlbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlbf_ f.21.2.1 (F:) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]}
mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
pnidykyfdykrth

SCOPe Domain Coordinates for d1qlbf_:

Click to download the PDB-style file with coordinates for d1qlbf_.
(The format of our PDB-style files is described here.)

Timeline for d1qlbf_: