Lineage for d1qlaf_ (1qla F:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 267974Fold f.21: Heme-binding four-helical bundle [81344] (2 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 267997Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 267998Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (1 protein)
    duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry
  6. 267999Protein Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56911] (1 species)
  7. 268000Species Wolinella succinogenes [TaxId:844] [56913] (3 PDB entries)
  8. 268002Domain d1qlaf_: 1qla F: [43723]
    Other proteins in same PDB: d1qlaa1, d1qlaa2, d1qlaa3, d1qlab1, d1qlab2, d1qlad1, d1qlad2, d1qlad3, d1qlae1, d1qlae2

Details for d1qlaf_

PDB Entry: 1qla (more details), 2.2 Å

PDB Description: respiratory complex ii-like fumarate reductase from wolinella succinogenes

SCOP Domain Sequences for d1qlaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlaf_ f.21.2.1 (F:) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes}
mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
pnidykyfdykrth

SCOP Domain Coordinates for d1qlaf_:

Click to download the PDB-style file with coordinates for d1qlaf_.
(The format of our PDB-style files is described here.)

Timeline for d1qlaf_: