Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (2 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (1 protein) duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry |
Protein Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56911] (1 species) |
Species Wolinella succinogenes [TaxId:844] [56913] (3 PDB entries) |
Domain d1qlaf_: 1qla F: [43723] Other proteins in same PDB: d1qlaa1, d1qlaa2, d1qlaa3, d1qlab1, d1qlab2, d1qlad1, d1qlad2, d1qlad3, d1qlae1, d1qlae2 |
PDB Entry: 1qla (more details), 2.2 Å
SCOP Domain Sequences for d1qlaf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlaf_ f.21.2.1 (F:) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes} mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd pnidykyfdykrth
Timeline for d1qlaf_: