Details for d1be3d3

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1be3d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3d3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus)}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

SCOP Domain Coordinates for d1be3d3:

Click to download the PDB-style file with coordinates for d1be3d3.
(The format of our PDB-style files is described here.)

Timeline for d1be3d3: