Lineage for d1be3d2 (1be3 D:1-195)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277141Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 277142Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 277439Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 277440Protein Cytochrome bc1 domain [46677] (3 species)
  7. 277451Species Cow (Bos taurus) [TaxId:9913] [46678] (5 PDB entries)
  8. 277454Domain d1be3d2: 1be3 D:1-195 [15955]
    Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3j_, d1be3k_
    complexed with fes, hec, hem

Details for d1be3d2

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1be3d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3d2 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus)}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOP Domain Coordinates for d1be3d2:

Click to download the PDB-style file with coordinates for d1be3d2.
(The format of our PDB-style files is described here.)

Timeline for d1be3d2: