Lineage for d1ee8a_ (1ee8 A:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 87210Fold e.14: DNA repair protein MutM (Fpg) [56735] (1 superfamily)
  4. 87211Superfamily e.14.1: DNA repair protein MutM (Fpg) [56736] (1 family) (S)
  5. 87212Family e.14.1.1: DNA repair protein MutM (Fpg) [56737] (1 protein)
  6. 87213Protein DNA repair protein MutM (Fpg) [56738] (1 species)
  7. 87214Species Thermus thermophilus [TaxId:274] [56739] (1 PDB entry)
  8. 87215Domain d1ee8a_: 1ee8 A: [43261]

Details for d1ee8a_

PDB Entry: 1ee8 (more details), 1.9 Å

PDB Description: crystal structure of mutm (fpg) protein from thermus thermophilus hb8

SCOP Domain Sequences for d1ee8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ee8a_ e.14.1.1 (A:) DNA repair protein MutM (Fpg) {Thermus thermophilus}
pelpevettrrrlrplvlgqtlrqvvhrdparyrntalaegrrilevdrrgkfllfaleg
gvelvahlgmtggfrleptphtraalvlegrtlyfhdprrfgrlfgvrrgdyreiplllr
lgpeplseafafpgffrglkesarplkallldqrlaagvgniyadealfrarlspfrpar
slteeearrlyralrevlaeavelggstlsdqsyrqpdglpggfqtrhavygreglpcpa
cgrpverrvvagrgthfcptcqgegp

SCOP Domain Coordinates for d1ee8a_:

Click to download the PDB-style file with coordinates for d1ee8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ee8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ee8b_