Lineage for d4bdpa2 (4bdp A:469-876)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 140913Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 140914Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
  5. 140915Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 140916Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 140917Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (4 PDB entries)
  8. 140920Domain d4bdpa2: 4bdp A:469-876 [43003]
    Other proteins in same PDB: d4bdpa1

Details for d4bdpa2

PDB Entry: 4bdp (more details), 1.8 Å

PDB Description: crystal structure of bacillus dna polymerase i fragment complexed to 11 base pairs of duplex dna after addition of two datp residues

SCOP Domain Sequences for d4bdpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bdpa2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOP Domain Coordinates for d4bdpa2:

Click to download the PDB-style file with coordinates for d4bdpa2.
(The format of our PDB-style files is described here.)

Timeline for d4bdpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bdpa1