![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) ![]() |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) |
![]() | Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) |
![]() | Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (4 PDB entries) |
![]() | Domain d4bdpa1: 4bdp A:297-468 [33710] Other proteins in same PDB: d4bdpa2 |
PDB Entry: 4bdp (more details), 1.8 Å
SCOP Domain Sequences for d4bdpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bdpa1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed} aamaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvraaakm kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn
Timeline for d4bdpa1: