Lineage for d1taqa4 (1taq A:423-832)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2246834Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2246835Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 2246901Species Thermus aquaticus [TaxId:271] [56676] (29 PDB entries)
  8. 2246922Domain d1taqa4: 1taq A:423-832 [42991]
    Other proteins in same PDB: d1taqa1, d1taqa2, d1taqa3
    complexed with bgl, zn

Details for d1taqa4

PDB Entry: 1taq (more details), 2.4 Å

PDB Description: structure of taq dna polymerase
PDB Compounds: (A:) taq DNA polymerase

SCOPe Domain Sequences for d1taqa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1taqa4 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlcccdpnlqnipvrtplgqrirrgfiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

SCOPe Domain Coordinates for d1taqa4:

Click to download the PDB-style file with coordinates for d1taqa4.
(The format of our PDB-style files is described here.)

Timeline for d1taqa4: