Lineage for d1fr6b_ (1fr6 B:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1232773Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1232774Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1232775Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1232789Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1232790Species Citrobacter freundii [TaxId:546] [56619] (3 PDB entries)
  8. 1232795Domain d1fr6b_: 1fr6 B: [42737]
    complexed with azr

Details for d1fr6b_

PDB Entry: 1fr6 (more details), 2.5 Å

PDB Description: refined crystal structure of beta-lactamase from citrobacter freundii indicates a mechanism for beta-lactam hydrolysis
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d1fr6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fr6b_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Citrobacter freundii [TaxId: 546]}
aakteqqiadivnrtitplmqeqaipgmavaiiyqgkpyyftwgkadiannrpvtqqtlf
elgsvsktfngvlggdaiargeiklsdpvtqywpeltgkqwqgisllhlatytagglplq
vpddvtdkaallrfyqnwqpqwapgakrlyanssiglfgalavkpsgmsyeeamskrvlh
plklahtwitvpqseqkdyawgyregkpvhvspgqldaeaygvkssvidmtrwvqanmda
sqvqektlqqgielaqsrywrigdmyqglgwemlnwpvkadsiisgsdskvalaalpave
vnppapavkaswvhktgstggfgsyvafvpeknlgivmlanksypnpvrveaawrilekl
q

SCOPe Domain Coordinates for d1fr6b_:

Click to download the PDB-style file with coordinates for d1fr6b_.
(The format of our PDB-style files is described here.)

Timeline for d1fr6b_: