SCOP 1.63: Domain d1fzgf1: 1fzg F:142-393

Lineage for d1fzgf1 (1fzg F:142-393)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family)

5. Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)

6. Protein Fibrinogen C-terminal domains [56498] (7 species)

7. Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (15 PDB entries)

8. Domain d1fzgf1: 1fzg F:142-393 [42471]
   Other proteins in same PDB: d1fzga_, d1fzgb2, d1fzgc2, d1fzgd_, d1fzge2, d1fzgf2
   complexed with ca, nag

Details for d1fzgf1

PDB Entry: 1fzg, 2.5 Å

PDB Description: crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzgf1:

Sequence; same for both SEQRES and ATOM records:

>d1fzgf1 d.171.1.1 (F:142-393) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrlt

Timeline for d1fzgf1:

• d1fzgf1 first appeared (with stable ids) in SCOP 1.55
  
• d1fzgf1 appears in SCOP 1.61
  
• d1fzgf1 appears in SCOP 1.65
  
• d1fzgf1 appears in the current release, SCOPe 2.08