Lineage for d1fzcf1 (1fzc F:142-397)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139662Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
  4. 139663Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 139664Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 139665Protein Fibrinogen C-terminal domains [56498] (5 species)
  7. 139694Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (11 PDB entries)
  8. 139702Domain d1fzcf1: 1fzc F:142-397 [42463]
    Other proteins in same PDB: d1fzca1, d1fzcb2, d1fzcc2, d1fzcd1, d1fzce2, d1fzcf2

Details for d1fzcf1

PDB Entry: 1fzc (more details), 2.3 Å

PDB Description: crystal structure of fragment double-d from human fibrin with two different bound ligands

SCOP Domain Sequences for d1fzcf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzcf1 d.171.1.1 (F:142-397) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrltigeg

SCOP Domain Coordinates for d1fzcf1:

Click to download the PDB-style file with coordinates for d1fzcf1.
(The format of our PDB-style files is described here.)

Timeline for d1fzcf1: