Lineage for d1prea1 (1pre A:2-84)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001993Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (3 proteins)
    automatically mapped to Pfam PF03440
  6. 3002008Protein Proaerolysin, N-terminal domain [56470] (1 species)
  7. 3002009Species Aeromonas hydrophila [TaxId:644] [56471] (6 PDB entries)
  8. 3002020Domain d1prea1: 1pre A:2-84 [42437]
    Other proteins in same PDB: d1prea2, d1preb2

Details for d1prea1

PDB Entry: 1pre (more details), 2.8 Å

PDB Description: proaerolysin
PDB Compounds: (A:) proaerolysin

SCOPe Domain Sequences for d1prea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prea1 d.169.1.2 (A:2-84) Proaerolysin, N-terminal domain {Aeromonas hydrophila [TaxId: 644]}
epvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpgy
ngeikpgtasntwcyptnpvtge

SCOPe Domain Coordinates for d1prea1:

Click to download the PDB-style file with coordinates for d1prea1.
(The format of our PDB-style files is described here.)

Timeline for d1prea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1prea2