Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Tetranectin [56465] (1 species) trimeric plasminogen binding protein with an alpha-helical coiled coil |
Species Human (Homo sapiens) [TaxId:9606] [56466] (3 PDB entries) Uniprot P05452 85-202 |
Domain d1tn3a_: 1tn3 A: [42423] complexed with ca, eoh, so4 |
PDB Entry: 1tn3 (more details), 2 Å
SCOPe Domain Sequences for d1tn3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tn3a_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]} alqtvclkgtkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsv gneaeiwlglndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwf dkrcrdqlpyicqfgiv
Timeline for d1tn3a_: