SCOPe 2.03: Domain d1tn3a_: 1tn3 A:

Lineage for d1tn3a_ (1tn3 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Tetranectin [56465] (1 species)
   trimeric plasminogen binding protein with an alpha-helical coiled coil

7. Species Human (Homo sapiens) [TaxId:9606] [56466] (3 PDB entries)
   Uniprot P05452 85-202

8. Domain d1tn3a_: 1tn3 A: [42423]
   complexed with ca, eoh, so4

Details for d1tn3a_

PDB Entry: 1tn3, 2 Å

PDB Description: the c-type lectin carbohydrate recognition domain of human tetranectin

PDB Compounds: (A:) tetranectin

SCOPe Domain Sequences for d1tn3a_:

Sequence; same for both SEQRES and ATOM records:

>d1tn3a_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]}
alqtvclkgtkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsv
gneaeiwlglndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwf
dkrcrdqlpyicqfgiv

Timeline for d1tn3a_:

• d1tn3a_ first appeared (with stable ids) in SCOP 1.55, called d1tn3__
  
• d1tn3a_ appears in SCOPe 2.02
  
• d1tn3a_ appears in SCOPe 2.04
  
• d1tn3a_ appears in the current release, SCOPe 2.08